VMAT2 (SLC18A2) (NM_003054) Human Mass Spec Standard

CAT#: PH321342

SLC18A2 MS Standard C13 and N15-labeled recombinant protein (NP_003045)

Product Images

Coomassie blue staining of purified SLC18A2 protein (Cat# TP321342). The protein was produced from HEK293T cells transfected with SLC18A2 cDNA clone (Cat# RC221342) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221342
• Predicted MW: 55.5 kDa
• Protein Sequence:
  Sequence Link

  >RC221342 representing NM_003054
  Red=Cloning site Green=Tags(s)
  
  MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTAS
  ISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
  VQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASV
  YTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQ
  KGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGI
  LAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS
  VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPI
  KTKMYTQNNIQSYPIGEDEESESD
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003045
• RefSeq Size: 1898
• RefSeq ORF: 1542
• Synonyms: PKDYS2; SVAT; SVMT; VAT2; VMAT2
• Locus ID: 6571
• UniProt ID: Q05940
• Cytogenetics: 10q25.3
• Summary: This gene encodes an transmembrane protein that functions as an ATP-dependent transporter of monoamines, such as dopamine, norepinephrine, serotonin, and histamine. This protein transports amine neurotransmitters into synaptic vesicles. Polymorphisms in this gene may be associated with schizophrenia, bipolar disorder, and other neurological/psychiatric ailments. [provided by RefSeq, Jun 2018]
• Protein Families: Transmembrane
• Protein Pathways: Parkinson's disease