VCX3A (NM_016379) Human Mass Spec Standard
CAT#: PH321002
VCX3A MS Standard C13 and N15-labeled recombinant protein (NP_057463)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221002 |
Predicted MW | 20.1 kDa |
Protein Sequence |
>RC221002 protein sequence
Red=Cloning site Green=Tags(s) MSPKPRASGPPAKAREAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPPSQESQLEEPLSQESEVEEPLSQESQVEEPLSQESEV EEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057463 |
RefSeq Size | 1004 |
RefSeq ORF | 558 |
Synonyms | VCX-8r; VCX-A; VCX3; VCX8R; VCXA |
Locus ID | 51481 |
UniProt ID | Q9NNX9 |
Cytogenetics | Xp22.31 |
Summary | This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413983 | VCX3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413983 | Transient overexpression lysate of variable charge, X-linked 3A (VCX3A) |
USD 436.00 |
|
TP321002 | Recombinant protein of human variable charge, X-linked 3A (VCX3A), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review