C18orf26 (DYNAP) (NM_173629) Human Mass Spec Standard

CAT#: PH320689

C18orf26 MS Standard C13 and N15-labeled recombinant protein (NP_775900)

Product Images

Coomassie blue staining of purified DYNAP protein (Cat# TP320689). The protein was produced from HEK293T cells transfected with DYNAP cDNA clone (Cat# RC220689) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220689
• Predicted MW: 22.3 kDa
• Protein Sequence:
  Sequence Link

  >RC220689 representing NM_173629
  Red=Cloning site Green=Tags(s)
  
  MVADIKGNEQIEKYSWREACDTGSSRMDRKHGKYILNVEHSENQPPITHPNDQEAHSSICWCLPSNDITS
  DVSPNLTGVCVNPGILAHSRCLQSESCNTQVKEYCRNDWSMWKVFLACLLACVIMTAIGVLIICLVNNKG
  SANSSIVIQLSTNDGECVTVKPGTPSPACPPTMTTTSTVPASTATESTTSTATAATTSTEPITVAPTDHL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_775900
• RefSeq Size: 2027
• RefSeq ORF: 630
• Synonyms: C18orf26
• Locus ID: 284254
• UniProt ID: Q8N1N2
• Cytogenetics: 18q21.2
• Summary: Plays a role in the regulation of cell proliferation. Promotes activation of the AKT1 signaling pathway. Promotes phosphorylation of AKT1 at 'Ser-473'.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane