C18orf26 (DYNAP) (NM_173629) Human Recombinant Protein

CAT#: TP320689M

Recombinant protein of human chromosome 18 open reading frame 26 (C18orf26), 100 µg

Product Images

Coomassie blue staining of purified DYNAP protein (Cat# TP320689). The protein was produced from HEK293T cells transfected with DYNAP cDNA clone (Cat# RC220689) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220689 representing NM_173629
  Red=Cloning site Green=Tags(s)
  
  MVADIKGNEQIEKYSWREACDTGSSRMDRKHGKYILNVEHSENQPPITHPNDQEAHSSICWCLPSNDITS
  DVSPNLTGVCVNPGILAHSRCLQSESCNTQVKEYCRNDWSMWKVFLACLLACVIMTAIGVLIICLVNNKG
  SANSSIVIQLSTNDGECVTVKPGTPSPACPPTMTTTSTVPASTATESTTSTATAATTSTEPITVAPTDHL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_775900
• Locus ID: 284254
• UniProt ID: Q8N1N2
• Cytogenetics: 18q21.2
• Refseq Size: 2027
• Refseq ORF: 630
• Synonyms: C18orf26
• Summary: Plays a role in the regulation of cell proliferation. Promotes activation of the AKT1 signaling pathway. Promotes phosphorylation of AKT1 at 'Ser-473'.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane