NUDT2 (NM_147173) Human Mass Spec Standard
CAT#: PH319598
NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671702)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219598 |
Predicted MW | 17.3 kDa |
Protein Sequence |
>RC219598 representing NM_147173
Red=Cloning site Green=Tags(s) MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ FLCSIEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_671702 |
RefSeq Size | 978 |
RefSeq ORF | 441 |
Synonyms | APAH1 |
Locus ID | 318 |
UniProt ID | P50583 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011] |
Protein Pathways | Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403446 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407737 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420095 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403446 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3 |
USD 436.00 |
|
LY407737 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2 |
USD 436.00 |
|
LY420095 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 1 |
USD 436.00 |
|
PH302439 | NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671701) |
USD 3,255.00 |
|
TP302439 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2, 20 µg |
USD 867.00 |
|
TP319598 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review