Natriuretic Peptide Receptor C (NPR3) (NM_000908) Human Mass Spec Standard

CAT#: PH319453

NPR3 MS Standard C13 and N15-labeled recombinant protein (NP_000899)

Product Images

Coomassie blue staining of purified NPR3 protein (Cat# TP319453). The protein was produced from HEK293T cells transfected with NPR3 cDNA clone (Cat# RC219453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219453
• Predicted MW: 59.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219453 representing NM_000908
  Red=Cloning site Green=Tags(s)
  
  MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLT
  RVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA
  APVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLE
  RNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMT
  SGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNM
  EDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA
  MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSCGLEESAVTGIVVGA
  LLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSVA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000899
• RefSeq Size: 2651
• RefSeq ORF: 1620
• Synonyms: ANP-C; ANPR-C; ANPRC; C5orf23; GUCY2B; NPR-C; NPRC
• Locus ID: 4883
• UniProt ID: P17342, Q60I31
• Cytogenetics: 5p13.3
• Summary: This gene encodes one of three natriuretic peptide receptors. Natriutetic peptides are small peptides which regulate blood volume and pressure, pulmonary hypertension, and cardiac function as well as some metabolic and growth processes. The product of this gene encodes a natriuretic peptide receptor responsible for clearing circulating and extracellular natriuretic peptides through endocytosis of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Transmembrane