Natriuretic Peptide Receptor C (NPR3) (NM_000908) Human Tagged ORF Clone

CAT#: RC219453

Reviews ()
Write a review

NPR3 (Myc-DDK-tagged)-Human natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) (NPR3), transcript variant 2



Reconstitution Protocol

USD 754.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NPR3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NPR3
Synonyms ANP-C; ANPR-C; ANPRC; C5orf23; GUCY2B; NPR-C; NPRC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219453 representing NM_000908
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTCTCTGCTGGTGCTCACTTTCTCCCCGTGCGTACTACTCGGCTGGGCGTTGCTGGCCGGCGGCA
CCGGTGGCGGTGGCGTTGGCGGCGGCGGCGGTGGCGCGGGCATAGGCGGCGGACGCCAGGAGAGAGAGGC
GCTGCCGCCACAGAAGATCGAGGTGCTGGTGTTACTGCCCCAGGATGACTCGTACTTGTTTTCACTCACC
CGGGTGCGGCCGGCCATCGAGTATGCTCTGCGCAGCGTGGAGGGCAACGGGACTGGGAGGCGGCTTCTGC
CGCCGGGCACTCGCTTCCAGGTGGCTTACGAGGATTCAGACTGTGGGAACCGTGCGCTCTTCAGCTTGGT
GGACCGCGTGGCGGCGGCGCGGGGCGCCAAGCCAGACCTTATCCTGGGGCCAGTGTGCGAGTATGCAGCA
GCGCCAGTGGCCCGGCTTGCATCGCACTGGGACCTGCCCATGCTGTCGGCTGGGGCGCTGGCCGCTGGCT
TCCAGCACAAGGACTCTGAGTACTCGCACCTCACGCGCGTGGCGCCCGCCTACGCCAAGATGGGCGAGAT
GATGCTCGCCCTGTTCCGCCACCACCACTGGAGCCGCGCTGCACTGGTCTACAGCGACGACAAGCTGGAG
CGGAACTGCTACTTCACCCTCGAGGGGGTCCACGAGGTCTTCCAGGAGGAGGGTTTGCACACGTCCATCT
ACAGTTTCGACGAGACCAAAGACTTGGATCTGGAAGACATCGTGCGCAATATCCAGGCCAGTGAGAGAGT
GGTGATCATGTGTGCGAGCAGTGACACCATCCGGAGCATCATGCTGGTGGCGCACAGGCATGGCATGACC
AGTGGAGACTACGCCTTCTTCAACATTGAGCTCTTCAACAGCTCTTCCTATGGAGATGGCTCATGGAAGA
GAGGAGACAAACACGACTTTGAAGCTAAGCAAGCATACTCGTCCCTCCAGACAGTCACTCTACTGAGGAC
AGTGAAACCTGAGTTTGAGAAGTTTTCCATGGAGGTGAAAAGTTCAGTTGAGAAACAAGGGCTCAATATG
GAGGATTACGTTAACATGTTTGTTGAAGGATTCCACGATGCCATCCTCCTCTACGTCTTGGCTCTACATG
AAGTACTCAGAGCTGGTTACAGCAAAAAGGATGGAGGGAAAATTATACAGCAGACTTGGAACAGAACATT
TGAAGGTATCGCCGGGCAGGTGTCCATAGATGCCAACGGAGACCGATATGGGGATTTCTCTGTGATTGCC
ATGACTGATGTGGAGGCGGGCACCCAGGAGGTTATTGGTGATTATTTTGGAAAAGAAGGTCGTTTTGAAA
TGCGGCCGAATGTCAAATATCCTTGGGGCCCTTTAAAACTGAGAATAGATGAAAACCGAATTGTAGAGCA
TACAAACAGCTCTCCCTGCAAATCATGTGGCCTAGAAGAATCGGCAGTGACAGGAATTGTCGTGGGGGCT
TTACTAGGAGCTGGCTTGCTAATGGCCTTCTACTTTTTCAGGAAGAAATACAGAATAACCATTGAGAGGC
GAACCCAGCAAGAAGAAAGTAACCTTGGAAAACATCGGGAATTACGGGAAGATTCCATCAGATCCCATTT
TTCAGTAGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219453 representing NM_000908
Red=Cloning site Green=Tags(s)

MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLT
RVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA
APVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLE
RNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMT
SGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNM
EDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA
MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSCGLEESAVTGIVVGA
LLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSVA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000908
ORF Size 1620 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000908.4
RefSeq Size 2651 bp
RefSeq ORF 1623 bp
Locus ID 4883
UniProt ID P17342
Cytogenetics 5p13.3
Domains ANF_receptor
Protein Families Druggable Genome, Transmembrane
MW 59.6 kDa
Gene Summary This gene encodes one of three natriuretic peptide receptors. Natriutetic peptides are small peptides which regulate blood volume and pressure, pulmonary hypertension, and cardiac function as well as some metabolic and growth processes. The product of this gene encodes a natriuretic peptide receptor responsible for clearing circulating and extracellular natriuretic peptides through endocytosis of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.