UBXN2B (NM_001077619) Human Mass Spec Standard

CAT#: PH319137

UBXN2B MS Standard C13 and N15-labeled recombinant protein (NP_001071087)

Product Images

Coomassie blue staining of purified UBXN2B protein (Cat# TP319137). The protein was produced from HEK293T cells transfected with UBXN2B cDNA clone (Cat# RC219137) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219137
• Predicted MW: 37.1 kDa
• Protein Sequence:
  Sequence Link

  >RC219137 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEGGGPEPGEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHE
  YSGLNIVRPSTGKIVNELFKEAREHGAVPLNEATRASGDDKSKSFTGGGYRLGSSFCKRSEYIYGENQLQ
  DVQILLKLWSNGFSLDDGELRPYNEPTNAQFLESVKRGEIPLELQRLVHGGQVNLDMEDHQDQEYIKPRL
  RFKAFSGEGQKLGSLTPEIVSTPSSPEEEDKSILNAVVLIDDSVPTTKIQIRLADGSRLIQRFNSTHRIL
  DVRNFIVQSRPEFAALDFILVTSFPNKELTDESLTLLEADILNTVLLQQLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001071087
• RefSeq Size: 5088
• RefSeq ORF: 993
• Synonyms: p37
• Locus ID: 137886
• UniProt ID: Q14CS0
• Cytogenetics: 8q12.1
• Summary: Adapter protein required for Golgi and endoplasmic reticulum biogenesis (PubMed:17141156). Involved in Golgi and endoplasmic reticulum maintenance during interphase and in their reassembly at the end of mitosis (PubMed:17141156). The complex formed with VCP has membrane fusion activity; membrane fusion activity requires USO1-GOLGA2 tethering and BET1L (PubMed:17141156). VCPIP1 is also required, but not its deubiquitinating activity (PubMed:17141156). Together with NSFL1C/p47, regulates the centrosomal levels of kinase AURKA/Aurora A during mitotic progression by promoting AURKA removal from centrosomes in prophase (PubMed:23649807). Also, regulates spindle orientation during mitosis (PubMed:23649807).[UniProtKB/Swiss-Prot Function]