TTC36 (NM_001080441) Human Mass Spec Standard

CAT#: PH318535

TTC36 MS Standard C13 and N15-labeled recombinant protein (NP_001073910)

Product Images

Coomassie blue staining of purified TTC36 protein (Cat# TP318535). The protein was produced from HEK293T cells transfected with TTC36 cDNA clone (Cat# RC218535) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218535
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC218535 representing NM_001080441
  Red=Cloning site Green=Tags(s)
  
  MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVMAAEAGDLSTA
  LERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGRAARQSFVQRGLLARLQGRDD
  DARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLRRPRDSR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001073910
• RefSeq Size: 679
• RefSeq ORF: 567
• Synonyms: HBP21
• Locus ID: 143941
• UniProt ID: A6NLP5
• Cytogenetics: 11q23.3
• Summary: The protein encoded by this gene has three tetratricopeptide repeats and is a chaperone for heat shock protein 70. The encoded protein may function as a tumor suppressor in hepatocellular carcinoma (HCC) since it promotes apoptosis but is downregulated in HCC. [provided by RefSeq, Sep 2016]