TTC36 (NM_001080441) Human Recombinant Protein
CAT#: TP318535
Recombinant protein of human tetratricopeptide repeat domain 36 (TTC36), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218535 representing NM_001080441
Red=Cloning site Green=Tags(s) MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVMAAEAGDLSTA LERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGRAARQSFVQRGLLARLQGRDD DARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLRRPRDSR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001073910 |
Locus ID | 143941 |
UniProt ID | A6NLP5 |
Cytogenetics | 11q23.3 |
Refseq Size | 679 |
Refseq ORF | 567 |
Synonyms | HBP21 |
Summary | The protein encoded by this gene has three tetratricopeptide repeats and is a chaperone for heat shock protein 70. The encoded protein may function as a tumor suppressor in hepatocellular carcinoma (HCC) since it promotes apoptosis but is downregulated in HCC. [provided by RefSeq, Sep 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421658 | TTC36 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421658 | Transient overexpression lysate of tetratricopeptide repeat domain 36 (TTC36) |
USD 436.00 |
|
PH318535 | TTC36 MS Standard C13 and N15-labeled recombinant protein (NP_001073910) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review