CACNB1 (NM_199247) Human Mass Spec Standard
CAT#: PH317910
CACNB1 MS Standard C13 and N15-labeled recombinant protein (NP_954855)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217910 |
Predicted MW | 57.7 kDa |
Protein Sequence |
>RC217910 representing NM_199247
Red=Cloning site Green=Tags(s) MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS DVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEPKDFLHIKEKY NNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLGDVVTGTRRPTPPASG NEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPPPHGKRIPFFKKTEHVPPYDVVPSMRPIILV GPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLAEVQSE IERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASE KLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALAASPAPVSNLQV QVLTSLRRNLGFWGGLESSQRGSVVPQEQEHAM TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_954855 |
RefSeq Size | 1847 |
RefSeq ORF | 1569 |
Synonyms | CAB1; CACNLB1; CCHLB1 |
Locus ID | 782 |
UniProt ID | Q02641, Q02641-2 |
Cytogenetics | 17q12 |
Summary | The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403703 | CACNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC404593 | CACNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC424552 | CACNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403703 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2 |
USD 665.00 |
|
LY404593 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3 |
USD 665.00 |
|
LY424552 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1 |
USD 436.00 |
|
PH307230 | CACNB1 MS Standard C13 and N15-labeled recombinant protein (NP_000714) |
USD 3,255.00 |
|
TP307230 | Recombinant protein of human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP317910 | Recombinant protein of human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review