MTCP1 (NM_001018025) Human Mass Spec Standard

CAT#: PH317513

MTCP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018025)

Product Images

Coomassie blue staining of purified MTCP1 protein (Cat# TP317513). The protein was produced from HEK293T cells transfected with MTCP1 cDNA clone (Cat# RC217513) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217513
• Predicted MW: 12.4 kDa
• Protein Sequence:
  Sequence Link

  >RC217513 representing NM_001018025
  Red=Cloning site Green=Tags(s)
  
  MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ
  LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001018025
• RefSeq Size: 1943
• RefSeq ORF: 321
• Synonyms: p8MTCP1; P13MTCP1; TCL1C
• Locus ID: 4515
• UniProt ID: P56278
• Cytogenetics: Xq28
• Summary: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq, Mar 2009]