MTCP1 (NM_001018025) Human Recombinant Protein
CAT#: TP317513
Recombinant protein of human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, transcript variant B1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217513 representing NM_001018025
Red=Cloning site Green=Tags(s) MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001018025 |
Locus ID | 4515 |
UniProt ID | P56278 |
Cytogenetics | Xq28 |
Refseq Size | 1943 |
Refseq ORF | 321 |
Synonyms | p8MTCP1; P13MTCP1; TCL1C |
Summary | This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq, Mar 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415436 | MTCP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422698 | MTCP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415436 | Transient overexpression lysate of mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, transcript variant B1 |
USD 436.00 |
|
LY422698 | Transient overexpression lysate of mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
PH317513 | MTCP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018025) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review