MTCP1 (NM_001018025) Human Recombinant Protein

CAT#: TP317513

Recombinant protein of human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, transcript variant B1, 20 µg

Product Images

Coomassie blue staining of purified MTCP1 protein (Cat# TP317513). The protein was produced from HEK293T cells transfected with MTCP1 cDNA clone (Cat# RC217513) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217513 representing NM_001018025
  Red=Cloning site Green=Tags(s)
  
  MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ
  LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001018025
• Locus ID: 4515
• UniProt ID: P56278
• Cytogenetics: Xq28
• Refseq Size: 1943
• Refseq ORF: 321
• Synonyms: p8MTCP1; P13MTCP1; TCL1C
• Summary: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq, Mar 2009]