MAK3 (NAA30) (NM_001011713) Human Mass Spec Standard

CAT#: PH316714

NAA30 MS Standard C13 and N15-labeled recombinant protein (NP_001011713)

Product Images

Coomassie blue staining of purified NAA30 protein (Cat# TP316714). The protein was produced from HEK293T cells transfected with NAA30 cDNA clone (Cat# RC216714) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216714
• Predicted MW: 39.1 kDa
• Protein Sequence:
  Sequence Link

  >RC216714 representing NM_001011713
  Red=Cloning site Green=Tags(s)
  
  MAEVPPGPSSLLPPPAPPAPAAVEPRCPFPAGAALACCSEDEEDDEEHEGGGSRSPAGGESATVAAKGHP
  CLRCPQPPQEQQQLNGLISPELRHLRAAASLKSKVLSVAEVAATTATPDGGPRATATKGAGVHSGERPPH
  SLSSNARTAVPSPVEAAAASDPAAARNGLAEGTEQEEEEEDEQVRLLSSSLTADCSLRSPSGREVEPGED
  RTIRYVRYESELQMPDIMRLITKDLSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAIVCKLDMHKKMFR
  RGYIAMLAVDSKYRRNGIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLN
  GVDALRLKLWLR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001011713
• RefSeq Size: 2891
• RefSeq ORF: 1086
• Synonyms: C14orf35; MAK3; Mak3p; NAT12; NAT12P
• Locus ID: 122830
• UniProt ID: Q147X3, B3KS28
• Cytogenetics: 14q22.3
• Summary: Catalytic subunit of the N-terminal acetyltransferase C (NatC) complex. Catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Leu-Ala and Met-Leu-Gly. Necessary for the lysosomal localization and function of ARL8B sugeesting that ARL8B is a NatC substrate.[UniProtKB/Swiss-Prot Function]