MAK3 (NAA30) Rabbit Polyclonal Antibody

CAT#: TA346682

Rabbit Polyclonal Anti-NAT12 Antibody

Product Images

WB Suggested Anti-NAT12 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NAT12 antibody: synthetic peptide directed towards the middle region of human NAT12. Synthetic peptide located within the following region: EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: N(alpha)-acetyltransferase 30, NatC catalytic subunit
• Database Link:
  NP_001011713
  Entrez Gene 122830 Human
  UniProt ID Q147X3
• Background: NAT12 belongs to the acetyltransferase family, MAK3 subfamily. It contains 1 N-acetyltransferase domain. It is a probable N-acetyltransferase.
• Synonyms: C14orf35; MAK3; Mak3p; NAT12; NAT12P
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Rat: 91%; Mouse: 91%