LHFPL2 (NM_005779) Human Mass Spec Standard

CAT#: PH314880

LHFPL2 MS Standard C13 and N15-labeled recombinant protein (NP_005770)

Product Images

Coomassie blue staining of purified LHFPL2 protein (Cat# TP314880). The protein was produced from HEK293T cells transfected with LHFPL2 cDNA clone (Cat# RC214880) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214880
• Predicted MW: 24.3 kDa
• Protein Sequence:
  Sequence Link

  >RC214880 representing NM_005779
  Red=Cloning site Green=Tags(s)
  
  MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRN
  PGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQ
  GIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATS
  SDKVQEEIEEGKNLICLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005770
• RefSeq Size: 4448
• RefSeq ORF: 684
• Locus ID: 10184
• UniProt ID: Q6ZUX7, A0A024RAM8
• Cytogenetics: 5q14.1
• Summary: This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane