LHFPL2 (NM_005779) Human Recombinant Protein
CAT#: TP314880
Recombinant protein of human lipoma HMGIC fusion partner-like 2 (LHFPL2), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214880 representing NM_005779
Red=Cloning site Green=Tags(s) MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRN PGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQ GIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATS SDKVQEEIEEGKNLICLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005770 |
Locus ID | 10184 |
UniProt ID | Q6ZUX7, A0A024RAM8 |
Cytogenetics | 5q14.1 |
Refseq Size | 4448 |
Refseq ORF | 684 |
Summary | This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417067 | LHFPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417067 | Transient overexpression lysate of lipoma HMGIC fusion partner-like 2 (LHFPL2) |
USD 436.00 |
|
PH314880 | LHFPL2 MS Standard C13 and N15-labeled recombinant protein (NP_005770) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review