LHFPL2 (NM_005779) Human Recombinant Protein

CAT#: TP314880

Recombinant protein of human lipoma HMGIC fusion partner-like 2 (LHFPL2), 20 µg

Product Images

Coomassie blue staining of purified LHFPL2 protein (Cat# TP314880). The protein was produced from HEK293T cells transfected with LHFPL2 cDNA clone (Cat# RC214880) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214880 representing NM_005779
  Red=Cloning site Green=Tags(s)
  
  MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRN
  PGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQ
  GIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATS
  SDKVQEEIEEGKNLICLL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005770
• Locus ID: 10184
• UniProt ID: Q6ZUX7, A0A024RAM8
• Cytogenetics: 5q14.1
• Refseq Size: 4448
• Refseq ORF: 684
• Summary: This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane