OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C17orf87 (SCIMP) (NM_207103) Human Mass Spec Standard

Be the first to review this product
SKU
PH313295
C17orf87 MS Standard C13 and N15-labeled recombinant protein (NP_996986)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404112 Transient overexpression lysate of chromosome 17 open reading frame 87 (C17orf87) (as WB positive control) 100 ug
$436.00

Other products for "C17orf87 or NM_207103"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213295
Predicted MW 16.6 kDa
Protein Sequence
Protein Sequence
>RC213295 protein sequence
Red=Cloning site Green=Tags(s)

MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYE
NVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANT
EKASF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996986
RefSeq Size 2424
RefSeq ORF 435
Synonyms C17orf87; UNQ5783
Locus ID 388325
UniProt ID Q6UWF3
Cytogenetics 17p13.2
Summary This gene encodes a transmembrane adaptor protein that is expressed in antigen-presenting cells and is localized in the immunologic synapse. The encoded protein is involved in major histocompatibility complex class II signal transduction and immune synapse formation. Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Dec 2012
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C17orf87" proteins (3)
SKU Description Size Price
LC404112 Lyophilized SCIMP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404112 Transient overexpression lysate of chromosome 17 open reading frame 87 (C17orf87) (as WB positive control) 100 ug
$436.00
TP313295 Recombinant protein of human chromosome 17 open reading frame 87 (C17orf87), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products