C17orf87 (SCIMP) (NM_207103) Human Recombinant Protein

CAT#: TP313295

Recombinant protein of human chromosome 17 open reading frame 87 (C17orf87), 20 µg

Product Images

Coomassie blue staining of purified SCIMP protein (Cat# TP313295). The protein was produced from HEK293T cells transfected with SCIMP cDNA clone (Cat# RC213295) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213295 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYE
  NVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANT
  EKASF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_996986
• Locus ID: 388325
• UniProt ID: Q6UWF3
• Cytogenetics: 17p13.2
• Refseq Size: 2424
• Refseq ORF: 435
• Synonyms: C17orf87; UNQ5783
• Summary: This gene encodes a transmembrane adaptor protein that is expressed in antigen-presenting cells and is localized in the immunologic synapse. The encoded protein is involved in major histocompatibility complex class II signal transduction and immune synapse formation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2012]
• Protein Families: Transmembrane