C17orf87 (SCIMP) (NM_207103) Human Recombinant Protein
CAT#: TP313295
Recombinant protein of human chromosome 17 open reading frame 87 (C17orf87), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213295 protein sequence
Red=Cloning site Green=Tags(s) MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYE NVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANT EKASF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996986 |
Locus ID | 388325 |
UniProt ID | Q6UWF3 |
Cytogenetics | 17p13.2 |
Refseq Size | 2424 |
Refseq ORF | 435 |
Synonyms | C17orf87; UNQ5783 |
Summary | This gene encodes a transmembrane adaptor protein that is expressed in antigen-presenting cells and is localized in the immunologic synapse. The encoded protein is involved in major histocompatibility complex class II signal transduction and immune synapse formation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404112 | SCIMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404112 | Transient overexpression lysate of chromosome 17 open reading frame 87 (C17orf87) |
USD 436.00 |
|
PH313295 | C17orf87 MS Standard C13 and N15-labeled recombinant protein (NP_996986) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review