Parathyroid hormone related protein (PTHLH) (NM_198966) Human Mass Spec Standard
CAT#: PH312744
PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_945317)
View other "Parathyroid hormone related protein" proteins (14)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212744 |
Predicted MW | 16 kDa |
Protein Sequence |
>RC212744 representing NM_198966
Red=Cloning site Green=Tags(s) MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_945317 |
RefSeq Size | 1312 |
RefSeq ORF | 531 |
Synonyms | BDE2; HHM; PLP; PTHR; PTHRP |
Locus ID | 5744 |
UniProt ID | P12272, A0A024RB29 |
Cytogenetics | 12p11.22 |
Summary | The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. [provided by RefSeq, Nov 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401000 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404641 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404642 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404643 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC430780 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401000 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 2 |
USD 436.00 |
|
LY404641 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 3 |
USD 436.00 |
|
LY404642 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 1 |
USD 436.00 |
|
LY404643 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 4 |
USD 436.00 |
|
LY430780 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 4 |
USD 436.00 |
|
PH312858 | PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_002811) |
USD 3,255.00 |
|
TP312744 | Recombinant protein of human parathyroid hormone-like hormone (PTHLH), transcript variant 4, 20 µg |
USD 867.00 |
|
TP312858 | Recombinant protein of human parathyroid hormone-like hormone (PTHLH), transcript variant 2, 20 µg |
USD 867.00 |
|
TP760737 | Purified recombinant protein of Human parathyroid hormone-like hormone (PTHLH), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review