TNFRSF4 (NM_003327) Human Mass Spec Standard
CAT#: PH311253
TNFRSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003318)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211253 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC211253 protein sequence
Red=Cloning site Green=Tags(s) MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPG FYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQA CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP GGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003318 |
RefSeq Size | 1120 |
RefSeq ORF | 831 |
Synonyms | ACT35; CD134; IMD16; OX40; TXGP1L |
Locus ID | 7293 |
UniProt ID | P43489 |
Cytogenetics | 1p36.33 |
Summary | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418746 | TNFRSF4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418746 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 4 (TNFRSF4) |
USD 436.00 |
|
TP311253 | Recombinant protein of human tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), 20 µg |
USD 867.00 |
|
TP700284 | Purified recombinant protein of human tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 867.00 |
|
TP723945 | Human OX40 Protein, hFc-His tag |
USD 520.00 |
{0} Product Review(s)
Be the first one to submit a review