OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TOR1AIP2 (NM_145034) Human Mass Spec Standard

Be the first to review this product
SKU
PH310930
TOR1AIP2 MS Standard C13 and N15-labeled recombinant protein (NP_659471)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331367 Rabbit Polyclonal Anti-TOR1AIP2 Antibody
100 ul
$585.00
LY403416 Transient overexpression lysate of torsin A interacting protein 2 (TOR1AIP2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "TOR1AIP2 or NM_145034"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210930
Predicted MW 51.3 kDa
Protein Sequence
Protein Sequence
>RC210930 protein sequence
Red=Cloning site Green=Tags(s)

MADSGLREPQEDSQKDLENDPSVNSQAQETTIIASNAEEAEILHSACGLSKDHQEVETEGPESADTGDKS
ESPDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPSDKVGRADAHLGSSSVALP
KEASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLRRRLLAPEAGSHPQQTQKLEEIKENAQDTMRQI
NKKGFWSYGPVILVVLVVAVVASSVNSYYSSPAQQVPKNPALEAFLAQFSQLEDKFPGQSSFLWQRGRKF
LQKHLNASNPTEPATIIFTAAREGRETLKCLSHHVADAYTSSQKVSPIQIDGAGRTWQDSDTVKLLVDLE
LSYGFENGQKAAVVHHFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLEASVGPRETEEKVRD
LLWAKFTNSDTPTSFNHMDSDKLSGLWSRISHLVLPVQPVSSIEEQGCLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659471
RefSeq Size 7912
RefSeq ORF 1410
Synonyms IFRG15; LULL1; NET9
Locus ID 163590
UniProt ID Q8NFQ8
Cytogenetics 1q25.2
Summary One of the two protein isoforms encoded by this gene is a type II integral membrane protein found in the endoplasmic reticulum (ER). The encoded protein is a cofactor for the ATPase TorsinA, regulating the amount of TorsinA present in the ER compared to that found in the nuclear envelope. Defects in this protein are a cause of early onset primary dystonia, a neuromuscular disease. The other isoform encoded by this gene is an interferon alpha responsive protein whose cellular role has yet to be determined. provided by RefSeq, Mar 2017
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TOR1AIP2" proteins (4)
SKU Description Size Price
LC403416 Lyophilized TOR1AIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403416 Transient overexpression lysate of torsin A interacting protein 2 (TOR1AIP2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP310930 Recombinant protein of human torsin A interacting protein 2 (TOR1AIP2), 20 µg 20 ug
$867.00
TP760750 Purified recombinant protein of Human torsin A interacting protein 2 (TOR1AIP2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products