galectin 9 (LGALS9) (NM_002308) Human Mass Spec Standard

CAT#: PH310750

LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_002299)

Product Images

Coomassie blue staining of purified LGALS9 protein (Cat# TP310750). The protein was produced from HEK293T cells transfected with LGALS9 cDNA clone (Cat# RC210750) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210750
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC210750 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGG
  YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSV
  QLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSIL
  LSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILC
  EAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002299
• RefSeq Size: 1739
• RefSeq ORF: 969
• Synonyms: HUAT; LGALS9A
• Locus ID: 3965
• UniProt ID: O00182, A0A024QZ02
• Cytogenetics: 17q11.2
• Summary: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]