Phosphoserine phosphatase (PSPH) (NM_004577) Human Mass Spec Standard
CAT#: PH309090
PSPH MS Standard C13 and N15-labeled recombinant protein (NP_004568)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209090 |
Predicted MW | 25 kDa |
Protein Sequence |
>RC209090 protein sequence
Red=Cloning site Green=Tags(s) MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQ PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFN GEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAK WYITDFVELLGELEE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004568 |
RefSeq Size | 2142 |
RefSeq ORF | 675 |
Synonyms | PSP; PSPHD |
Locus ID | 5723 |
UniProt ID | P78330, A0A024RDL3 |
Cytogenetics | 7p11.2 |
Summary | The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Glycine, serine and threonine metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417896 | PSPH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417896 | Transient overexpression lysate of phosphoserine phosphatase (PSPH) |
USD 436.00 |
|
TP309090 | Recombinant protein of human phosphoserine phosphatase (PSPH), 20 µg |
USD 867.00 |
|
TP720145 | Recombinant protein of human phosphoserine phosphatase (PSPH) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review