Phosphoserine phosphatase (PSPH) (NM_004577) Human Tagged ORF Clone

CAT#: RC209090

PSPH (Myc-DDK-tagged)-Human phosphoserine phosphatase (PSPH)

Product Images

Circular map for RC209090

• 

  Western blot validation of overexpression lysate (Cat# LY417896) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC209090 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified PSPH protein (Cat# TP309090). The protein was produced from HEK293T cells transfected with PSPH cDNA clone (Cat# RC209090) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Phosphoserine phosphatase
• Synonyms: PSP; PSPHD
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC209090 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTCTCCCACTCAGAGCTGAGGAAGCTTTTCTACTCAGCAGATGCTGTGTGTTTTGATGTTGACAGCA
  CGGTCATCAGAGAAGAAGGAATCGATGAGCTAGCCAAAATCTGTGGCGTTGAGGACGCGGTGTCAGAAAT
  GACACGGCGAGCCATGGGCGGGGCAGTGCCTTTCAAAGCTGCTCTCACAGAGCGCTTAGCCCTCATCCAG
  CCCTCCAGGGAGCAGGTGCAGAGACTCATAGCAGAGCAACCCCCACACCTGACCCCCGGCATAAGGGAGC
  TGGTAAGTCGCCTACAGGAGCGAAATGTTCAGGTTTTCCTAATATCTGGTGGCTTTAGGAGTATTGTAGA
  GCATGTTGCTTCAAAGCTCAATATCCCAGCAACCAATGTATTTGCCAATAGGCTGAAATTCTACTTTAAC
  GGTGAATATGCAGGTTTTGATGAGACGCAGCCAACAGCTGAATCTGGTGGAAAAGGAAAAGTGATTAAAC
  TTTTAAAGGAAAAATTTCATTTTAAGAAAATAATCATGATTGGAGATGGTGCCACAGATATGGAAGCCTG
  TCCTCCTGCTGATGCTTTCATTGGATTTGGAGGAAATGTGATCAGGCAACAAGTCAAGGATAACGCCAAA
  TGGTATATCACTGATTTTGTAGAGCTGCTGGGAGAACTGGAAGAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC209090 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQ
  PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFN
  GEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAK
  WYITDFVELLGELEE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_004577
• ORF Size: 675 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_004577.4
• RefSeq Size: 2142 bp
• RefSeq ORF: 678 bp
• Locus ID: 5723
• UniProt ID: P78330
• Cytogenetics: 7p11.2
• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Glycine, serine and threonine metabolism, Metabolic pathways
• MW: 25 kDa
• Gene Summary: The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. [provided by RefSeq, Jul 2008]