PLEKHA3 (NM_019091) Human Mass Spec Standard

CAT#: PH308433

PLEKHA3 MS Standard C13 and N15-labeled recombinant protein (NP_061964)

Product Images

Coomassie blue staining of purified PLEKHA3 protein (Cat# TP308433). The protein was produced from HEK293T cells transfected with PLEKHA3 cDNA clone (Cat# RC208433) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208433
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC208433 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQH
  FYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHH
  DENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSV
  SHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEE
  SRLMAKKQSESEDTLPSFSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061964
• RefSeq Size: 2516
• RefSeq ORF: 900
• Synonyms: FAPP1
• Locus ID: 65977
• UniProt ID: Q9HB20
• Cytogenetics: 2q31.2
• Summary: Involved in Golgi to cell surface membrane traffic. Induces membrane tubulation. Binds preferentially to phosphatidylinositol 4-phosphate (PtdIns4P).[UniProtKB/Swiss-Prot Function]