PLEKHA3 (NM_019091) Human Recombinant Protein

CAT#: TP308433

Recombinant protein of human pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 (PLEKHA3), 20 µg

Product Images

Coomassie blue staining of purified PLEKHA3 protein (Cat# TP308433). The protein was produced from HEK293T cells transfected with PLEKHA3 cDNA clone (Cat# RC208433) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208433 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQH
  FYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHH
  DENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSV
  SHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEE
  SRLMAKKQSESEDTLPSFSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061964
• Locus ID: 65977
• UniProt ID: Q9HB20
• Cytogenetics: 2q31.2
• Refseq Size: 2516
• Refseq ORF: 900
• Synonyms: FAPP1
• Summary: Involved in Golgi to cell surface membrane traffic. Induces membrane tubulation. Binds preferentially to phosphatidylinositol 4-phosphate (PtdIns4P).[UniProtKB/Swiss-Prot Function]