OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF11 (NM_014372) Human Mass Spec Standard

Be the first to review this product
SKU
PH308220
RNF11 MS Standard C13 and N15-labeled recombinant protein (NP_055187)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810976 RNF11 mouse monoclonal antibody,clone OTI1G7 100 ul
$447.00
LY402321 Transient overexpression lysate of ring finger protein 11 (RNF11) (as WB positive control) 100 ug
$436.00

Other products for "RNF11 or NM_014372"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208220
Predicted MW 17.4 kDa
Protein Sequence
Protein Sequence
>RC208220 protein sequence
Red=Cloning site Green=Tags(s)

MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRI
AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM
EPVDAALLSSYETN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055187
RefSeq Size 3082
RefSeq ORF 462
Synonyms CGI-123; SID1669
Locus ID 26994
UniProt ID Q9Y3C5
Cytogenetics 1p32.3
Summary The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN). provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF11" proteins (3)
SKU Description Size Price
LC402321 Lyophilized RNF11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402321 Transient overexpression lysate of ring finger protein 11 (RNF11) (as WB positive control) 100 ug
$436.00
TP308220 Recombinant protein of human ring finger protein 11 (RNF11), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products