PCYT1A (NM_005017) Human Mass Spec Standard

CAT#: PH308130

PCYT1A MS Standard C13 and N15-labeled recombinant protein (NP_005008)

Product Images

Coomassie blue staining of purified PCYT1A protein (Cat# TP308130). The protein was produced from HEK293T cells transfected with PCYT1A cDNA clone (Cat# RC208130) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208130
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208130 representing NM_005017
  Red=Cloning site Green=Tags(s)
  
  MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRG
  TPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCR
  YVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIV
  RDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEE
  KSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPAN
  LSRHKAAAYDISEDEED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005008
• RefSeq Size: 1677
• RefSeq ORF: 1101
• Synonyms: CCTA; CCTalpha; CT; CTA; CTPCT; PCYT1; SMDCRD
• Locus ID: 5130
• UniProt ID: P49585
• Cytogenetics: 3q29
• Summary: This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015]
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways