TP53I11 (NM_006034) Human Mass Spec Standard
CAT#: PH307402
TP53I11 MS Standard C13 and N15-labeled recombinant protein (NP_006025)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207402 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC207402 protein sequence
Red=Cloning site Green=Tags(s) MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA VLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIRWTLLTEACYF GVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYYQVGRRPKKA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006025 |
RefSeq Size | 3518 |
RefSeq ORF | 567 |
Synonyms | PIG11 |
Locus ID | 9537 |
UniProt ID | O14683 |
Cytogenetics | 11p11.2 |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416907 | TP53I11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421367 | TP53I11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425835 | TP53I11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416907 | Transient overexpression lysate of tumor protein p53 inducible protein 11 (TP53I11) |
USD 436.00 |
|
LY421367 | Transient overexpression lysate of tumor protein p53 inducible protein 11 (TP53I11) |
USD 436.00 |
|
TP307402 | Recombinant protein of human tumor protein p53 inducible protein 11 (TP53I11), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review