TP53I11 (NM_006034) Human Recombinant Protein

CAT#: TP307402

Recombinant protein of human tumor protein p53 inducible protein 11 (TP53I11), 20 µg

Product Images

Coomassie blue staining of purified TP53I11 protein (Cat# TP307402). The protein was produced from HEK293T cells transfected with TP53I11 cDNA clone (Cat# RC207402) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207402 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA
  VLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIRWTLLTEACYF
  GVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYYQVGRRPKKA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006025
• Locus ID: 9537
• UniProt ID: O14683
• Cytogenetics: 11p11.2
• Refseq Size: 3518
• Refseq ORF: 567
• Synonyms: PIG11
• Protein Families: Druggable Genome, Transmembrane