YJU2 (NM_018074) Human Mass Spec Standard

CAT#: PH305711

CCDC94 MS Standard C13 and N15-labeled recombinant protein (NP_060544)

Product Images

Coomassie blue staining of purified YJU2 protein (Cat# TP305711). The protein was produced from HEK293T cells transfected with YJU2 cDNA clone (Cat# RC205711) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205711
• Predicted MW: 37.1 kDa
• Protein Sequence:
  Sequence Link

  >RC205711 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEVYLG
  LPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENR
  TKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQETAALLEEARKRRLLED
  SDSEDEAAPSPLQPALRPNPTAILDEAPKPKRKVEVWEQSVGSLGSRPPLSRLVVVKKAKADPDCSNGQP
  QAAPTPGAPQNRKEANPTPLTPGASSLSQLGAYLDSDDSNGSN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060544
• RefSeq Size: 1441
• RefSeq ORF: 969
• Synonyms: CCDC94
• Locus ID: 55702
• UniProt ID: Q9BW85
• Cytogenetics: 19p13.3
• Summary: Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA (PubMed:29301961). Plays a role in stabilizing the structure of the spliceosome catalytic core and docking of the branch helix into the active site, producing 5'-exon and lariat intron-3'-intermediates (By similarity). May protect cells from TP53-dependent apoptosis upon dsDNA break damage through association with PRP19-CD5L complex (PubMed:22952453).[UniProtKB/Swiss-Prot Function]