MARCHF8 (NM_001002266) Human Mass Spec Standard
CAT#: PH305477
MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002266)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205477 |
Predicted MW | 32.9 kDa |
Protein Sequence |
>RC205477 protein sequence
Red=Cloning site Green=Tags(s) MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRT SITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTG GLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTE PEDTGAEIIHV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001002266 |
RefSeq Size | 4812 |
RefSeq ORF | 873 |
Synonyms | c-MIR; CMIR; MARCH-VIII; MARCH8; MIR; RNF178 |
Locus ID | 220972 |
UniProt ID | Q5T0T0, A0A024R7U2 |
Cytogenetics | 10q11.21-q11.22 |
Summary | MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408083 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424197 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424198 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408083 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8 |
USD 436.00 |
|
LY424197 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6 |
USD 436.00 |
|
LY424198 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7 |
USD 436.00 |
|
PH309891 | MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_659458) |
USD 3,255.00 |
|
PH311771 | MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002265) |
USD 3,255.00 |
|
TP305477 | Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7, 20 µg |
USD 867.00 |
|
TP309891 | Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8, 20 µg |
USD 867.00 |
|
TP311771 | Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review