ERLIN1 (NM_006459) Human Mass Spec Standard
CAT#: PH305137
ERLIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006450)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205137 |
Predicted MW | 38.9 kDa |
Protein Sequence |
>RC205137 protein sequence
Red=Cloning site Green=Tags(s) MTQARVLVAAVVGLVAVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDE VKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIEL FDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETE RKKAVIEAEKIAQVAKIRFQQKVMEKETEKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEY LELKKYQAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGRESSLPSKEALEPSGENVIQNKESTG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006450 |
RefSeq Size | 3450 |
RefSeq ORF | 1038 |
Synonyms | C10orf69; Erlin-1; KE04; KEO4; SPFH1; SPG62 |
Locus ID | 10613 |
UniProt ID | O75477 |
Cytogenetics | 10q24.31 |
Summary | The protein encoded by this gene is part of a protein complex that mediates degradation of inositol 1,4,5-trisphosphate receptors in the endoplasmic reticulum. The encoded protein also binds cholesterol and regulates the SREBP signaling pathway, which promotes cellular cholesterol homeostasis. Defects in this gene have been associated with spastic paraplegia 62. [provided by RefSeq, Dec 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416643 | ERLIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420288 | ERLIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416643 | Transient overexpression lysate of ER lipid raft associated 1 (ERLIN1) |
USD 436.00 |
|
LY420288 | Transient overexpression lysate of ER lipid raft associated 1 (ERLIN1) |
USD 436.00 |
|
TP305137 | Recombinant protein of human ER lipid raft associated 1 (ERLIN1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review