AMID (AIFM2) (NM_032797) Human Mass Spec Standard

CAT#: PH304934

AIFM2 MS Standard C13 and N15-labeled recombinant protein (NP_116186)

Product Images

Coomassie blue staining of purified AIFM2 protein (Cat# TP304934). The protein was produced from HEK293T cells transfected with AIFM2 cDNA clone (Cat# RC204934) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204934
• Predicted MW: 40.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204934 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYS
  VTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQ
  RSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVS
  NLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNV
  YAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLM
  VRLTKSRDLFVSTSWKTMRQSPP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_116186
• RefSeq Size: 3253
• RefSeq ORF: 1119
• Synonyms: AMID; FSP1; PRG3
• Locus ID: 84883
• UniProt ID: Q9BRQ8
• Cytogenetics: 10q22.1
• Summary: This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010]
• Protein Families: Druggable Genome, Transmembrane