AMID (AIFM2) Rabbit Polyclonal Antibody

CAT#: TA330412

Rabbit Polyclonal Anti-AIFM2 Antibody

Product Images

WB Suggested Anti-AIFM2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: Human brain

• 

  Placenta

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AIFM2 antibody: synthetic peptide directed towards the middle region of human AIFM2. Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: apoptosis inducing factor, mitochondria associated 2
• Database Link:
  NP_116186
  Entrez Gene 84883 Human
  UniProt ID Q9BRQ8
• Background: AIFM2 has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells.
• Synonyms: AMID; PRG3
• Note: Immunogen sequence homology: Human: 100%; Guinea pig: 93%; Rabbit: 93%; Chicken: 91%; Bovine: 86%; Dog: 86%; African clawed frog: 83%; Mouse: 80%; Rat: 80%

Reference Data

• Protein Families: Druggable Genome, Transmembrane