RAB8B (NM_016530) Human Mass Spec Standard
CAT#: PH304651
RAB8B MS Standard C13 and N15-labeled recombinant protein (NP_057614)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204651 |
Predicted MW | 23.6 kDa |
Protein Sequence |
>RC204651 protein sequence
Red=Cloning site Green=Tags(s) MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERF RTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLA IDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057614 |
RefSeq Size | 4877 |
RefSeq ORF | 621 |
Locus ID | 51762 |
UniProt ID | Q92930 |
Cytogenetics | 15q22.2 |
Summary | RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).[supplied by OMIM, Nov 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413924 | RAB8B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413924 | Transient overexpression lysate of RAB8B, member RAS oncogene family (RAB8B) |
USD 436.00 |
|
TP304651 | Recombinant protein of human RAB8B, member RAS oncogene family (RAB8B), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review