RAB8B (NM_016530) Human Tagged ORF Clone

CAT#: RC204651

Reviews ()
Write a review

RAB8B (Myc-DDK-tagged)-Human RAB8B, member RAS oncogene family (RAB8B)



Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Other products for "RAB8B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAB8B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204651 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAAGACGTACGATTATCTCTTCAAGCTCCTGCTGATCGGCGACTCGGGGGTAGGCAAGACCTGCC
TCCTGTTCCGCTTCTCAGAGGACGCCTTCAACACCACCTTCATCTCCACCATCGGAATTGATTTTAAAAT
TAGAACGATAGAACTAGATGGAAAGAAAATTAAGCTTCAGATATGGGACACAGCGGGTCAGGAAAGATTC
CGAACAATCACGACAGCGTACTACAGAGGAGCCATGGGCATTATGCTGGTCTATGACATCACAAATGAAA
AATCCTTTGACAATATTAAAAATTGGATCAGAAACATTGAAGAGCATGCCTCTTCCGATGTCGAAAGAAT
GATCCTGGGTAACAAATGTGATATGAATGACAAAAGACAAGTGTCAAAAGAAAGAGGGGAGAAGCTAGCA
ATTGACTATGGGATTAAATTCTTGGAGACAAGCGCAAAATCCAGTGCAAATGTAGAAGAGGCATTTTTTA
CACTTGCACGAGATATAATGACAAAACTCAACAGAAAAATGAATGACAGCAATTCAGCAGGAGCAGGTGG
ACCAGTGAAAATAACAGAAAACCGATCAAAGAAGACCAGTTTCTTTCGTTGCTCGCTACTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204651 protein sequence
Red=Cloning site Green=Tags(s)

MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERF
RTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLA
IDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016530
ORF Size 621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016530.3
RefSeq Size 4877 bp
RefSeq ORF 624 bp
Locus ID 51762
UniProt ID Q92930
Cytogenetics 15q22.2
Domains ras, RAN, RAS, RHO, RAB, ARF
Protein Families Druggable Genome
MW 23.6 kDa
Gene Summary RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).[supplied by OMIM, Nov 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.