GOLGA7 (NM_001002296) Human Mass Spec Standard
CAT#: PH304399
GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204399 |
Predicted MW | 15.8 kDa |
Protein Sequence |
>RC204399 protein sequence
Red=Cloning site Green=Tags(s) MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001002296 |
RefSeq Size | 2042 |
RefSeq ORF | 411 |
Synonyms | GCP16; GOLGA3AP1; GOLGA7A; HSPC041 |
Locus ID | 51125 |
UniProt ID | Q7Z5G4 |
Cytogenetics | 8p11.21 |
Summary | May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414189 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424147 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432569 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414189 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 1 |
USD 436.00 |
|
LY424147 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 2 |
USD 436.00 |
|
LY432569 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 3 |
USD 436.00 |
|
PH312483 | GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_057183) |
USD 3,255.00 |
|
TP304399 | Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 2, 20 µg |
USD 867.00 |
|
TP312483 | Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 1, 20 µg |
USD 867.00 |
|
TP329569 | Purified recombinant protein of Homo sapiens golgin A7 (GOLGA7), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review