CIAO2A (NM_032231) Human Mass Spec Standard

CAT#: PH303357

FAM96A MS Standard C13 and N15-labeled recombinant protein (NP_115607)

Product Images

Coomassie blue staining of purified CIAO2A protein (Cat# TP303357). The protein was produced from HEK293T cells transfected with CIAO2A cDNA clone (Cat# RC203357) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203357
• Predicted MW: 18.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203357 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQ
  EINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVA
  AAMENPNLREIVEQCVLEPD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115607
• RefSeq Size: 1114
• RefSeq ORF: 480
• Synonyms: CIA2A; FAM96A
• Locus ID: 84191
• UniProt ID: Q9H5X1
• Cytogenetics: 15q22.31
• Summary: Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:23891004). As a CIA complex component and in collaboration with CIAO1 specifically matures ACO1 and stabilizes IREB2, connecting cytosolic iron-sulfur protein maturation with cellular iron regulation (PubMed:23891004). May play a role in chromosome segregation through establishment of sister chromatid cohesion. May induce apoptosis in collaboration with APAF1 (PubMed:25716227).[UniProtKB/Swiss-Prot Function]