SIKE1 (NM_025073) Human Mass Spec Standard

CAT#: PH303262

SIKE1 MS Standard C13 and N15-labeled recombinant protein (NP_079349)

Product Images

Coomassie blue staining of purified SIKE1 protein (Cat# TP303262). The protein was produced from HEK293T cells transfected with SIKE1 cDNA clone (Cat# RC203262) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203262
• Predicted MW: 23.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203262 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASDMKDMSKYKPH
  ILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIES
  QIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079349
• RefSeq Size: 5507
• RefSeq ORF: 621
• Synonyms: SIKE
• Locus ID: 80143
• UniProt ID: Q9BRV8
• Cytogenetics: 1p13.2
• Summary: SIKE interacts with IKK-epsilon (IKBKE; MIM 605048) and TBK1 (MIM 604834) and acts as a suppressor of TLR3 (MIM 603029) and virus-triggered interferon activation pathways (Huang et al., 2005 [PubMed 16281057]).[supplied by OMIM, Mar 2008]
• Protein Pathways: RIG-I-like receptor signaling pathway