Density Regulated Protein (DENR) (NM_003677) Human Mass Spec Standard

CAT#: PH303227

DENR MS Standard C13 and N15-labeled recombinant protein (NP_003668)

Product Images

Coomassie blue staining of purified DENR protein (Cat# TP303227). The protein was produced from HEK293T cells transfected with DENR cDNA clone (Cat# RC203227) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203227
• Predicted MW: 22.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203227 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTV
  ENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEID
  LKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003668
• RefSeq Size: 3061
• RefSeq ORF: 594
• Synonyms: DRP; DRP1; SMAP-3
• Locus ID: 8562
• UniProt ID: O43583, A0A024RBR3
• Cytogenetics: 12q24.31
• Summary: This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. [provided by RefSeq, Jul 2008]