MAP3K12 binding inhibitory protein 1 (MBIP) (NM_016586) Human Mass Spec Standard
CAT#: PH302668
MBIP MS Standard C13 and N15-labeled recombinant protein (NP_057670)
View other "MAP3K12 binding inhibitory protein 1" proteins (6)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202668 |
Predicted MW | 39.3 kDa |
Protein Sequence |
>RC202668 protein sequence
Red=Cloning site Green=Tags(s) MAAATEHNRPSSGDRNLERRCSPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKLQSLSAFQPAL LFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFSIGDLQEEEKHKESDLRDVKK TQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSH VKVSRVVYTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLED KILELEGISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057670 |
RefSeq Size | 1661 |
RefSeq ORF | 1032 |
Locus ID | 51562 |
UniProt ID | Q9NS73, B2RCV0 |
Cytogenetics | 14q13.3 |
Summary | Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413886 | MBIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428551 | MBIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413886 | Transient overexpression lysate of MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 1 |
USD 436.00 |
|
LY428551 | Transient overexpression lysate of MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 2 |
USD 436.00 |
|
TP302668 | Recombinant protein of human MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 1, 20 µg |
USD 867.00 |
|
TP720564 | Recombinant protein of human MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review