SUSD4 (NM_001037175) Human Mass Spec Standard
CAT#: PH302622
SUSD4 MS Standard C13 and N15-labeled recombinant protein (NP_001032252)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202622 |
Predicted MW | 32.2 kDa |
Protein Sequence |
>RC202622 protein sequence
Red=Cloning site Green=Tags(s) MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTP SGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHG EKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRC FPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTC SSTSTTTSLF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001032252 |
RefSeq Size | 1114 |
RefSeq ORF | 870 |
Synonyms | PRO222 |
Locus ID | 55061 |
UniProt ID | Q5VX71, A0A140VK55 |
Cytogenetics | 1q41 |
Summary | Acts as complement inhibitor by disrupting the formation of the classical C3 convertase. Isoform 3 inhibits the classical complement pathway, while membrane-bound isoform 1 inhibits deposition of C3b via both the classical and alternative complement pathways.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413412 | SUSD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC421931 | SUSD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413412 | Transient overexpression lysate of sushi domain containing 4 (SUSD4), transcript variant 1 |
USD 665.00 |
|
LY421931 | Transient overexpression lysate of sushi domain containing 4 (SUSD4), transcript variant 2 |
USD 436.00 |
|
TP302622 | Recombinant protein of human sushi domain containing 4 (SUSD4), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review