Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Mass Spec Standard
CAT#: PH301830
SEPHS2 MS Standard C13 and N15-labeled recombinant protein (NP_036380)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201830 |
Predicted MW | 47.1 kDa |
Protein Sequence |
>RC201830 protein sequence
Red=Cloning site Green=Tags(s) MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQEALL KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFF YPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAV TGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVS REEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKM AAVSKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKP RVIEVLPRGATAAVLAPDSSNASSEPSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036380 |
RefSeq Size | 2351 |
RefSeq ORF | 1344 |
Synonyms | SPS2 |
Locus ID | 22928 |
UniProt ID | Q99611 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes an enzyme that catalyzes the production of monoselenophosphate (MSP) from selenide and ATP. MSP is the selenium donor required for synthesis of selenocysteine (Sec), which is co-translationally incorporated into selenoproteins at in-frame UGA codons that normally signal translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein is itself a selenoprotein containing a Sec residue at its active site, suggesting the existence of an autoregulatory mechanism. It is preferentially expressed in tissues implicated in the synthesis of selenoproteins and in sites of blood cell development. A pseudogene for this locus has been identified on chromosome 5. [provided by RefSeq, May 2017] |
Protein Pathways | Metabolic pathways, Selenoamino acid metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402179 | SEPHS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402179 | Transient overexpression lysate of selenophosphate synthetase 2 (SEPHS2) |
USD 436.00 |
|
TP301830 | SEPHS2 (Myc-DDK-tagged)-Human selenophosphate synthetase 2 (SEPHS2), (Note, selenocysteine protein, internal stop codon, see reference data summary), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review