PEX19 (NM_002857) Human Mass Spec Standard
CAT#: PH301756
PEX19 MS Standard C13 and N15-labeled recombinant protein (NP_002848)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201756 |
Predicted MW | 32.8 kDa |
Protein Sequence |
>RC201756 protein sequence
Red=Cloning site Green=Tags(s) MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKF FQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNA TDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESL PPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDL DALNLSGPPGASGEQCLIM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002848 |
RefSeq Size | 3722 |
RefSeq ORF | 897 |
Synonyms | D1S2223E; HK33; PBD12A; PMP1; PMPI; PXF; PXMP1 |
Locus ID | 5824 |
UniProt ID | P40855, A0A0S2Z497 |
Cytogenetics | 1q23.2 |
Summary | This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. These disorders have at least 14 complementation groups, with more than one phenotype being observed for some complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14), which is also known as PBD-CGJ. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419085 | PEX19 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419085 | Transient overexpression lysate of peroxisomal biogenesis factor 19 (PEX19), transcript variant 1 |
USD 436.00 |
|
TP301756 | Recombinant protein of human peroxisomal biogenesis factor 19 (PEX19), transcript variant 1, 20 µg |
USD 867.00 |
|
TP325241 | Purified recombinant protein of Homo sapiens peroxisomal biogenesis factor 19 (PEX19), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review