RHOD (NM_014578) Human Mass Spec Standard

CAT#: PH301722

RHOD MS Standard C13 and N15-labeled recombinant protein (NP_055393)

Product Images

Coomassie blue staining of purified RHOD protein (Cat# TP301722). The protein was produced from HEK293T cells transfected with RHOD cDNA clone (Cat# RC201722) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201722
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201722 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIW
  DTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLV
  NKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055393
• RefSeq Size: 1150
• RefSeq ORF: 630
• Synonyms: ARHD; Rho; RHOHP1; RHOM
• Locus ID: 29984
• UniProt ID: O00212
• Cytogenetics: 11q13.2
• Summary: Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
• Protein Pathways: Axon guidance