MOBK1B (MOB1A) (NM_018221) Human Mass Spec Standard

CAT#: PH301487

MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691)

Product Images

Coomassie blue staining of purified MOB1A protein (Cat# TP301487). The protein was produced from HEK293T cells transfected with MOB1A cDNA clone (Cat# RC201487) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201487
• Predicted MW: 24.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201487 representing NM_018221
  Red=Cloning site Green=Tags(s)
  
  MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINM
  LYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF
  PKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
  LGSKDR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060691
• RefSeq Size: 2543
• RefSeq ORF: 648
• Synonyms: C2orf6; MATS1; MOB1; Mob4B; MOBK1B; MOBKL1B
• Locus ID: 55233
• UniProt ID: Q9H8S9
• Cytogenetics: 2p13.1
• Summary: The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome