BRP44L (MPC1) (NM_016098) Human Mass Spec Standard
CAT#: PH301461
BRP44L MS Standard C13 and N15-labeled recombinant protein (NP_057182)
Frequently bought together (2)
Other products for "BRP44L"
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201461 |
Predicted MW | 12.3 kDa |
Protein Sequence |
>RC201461 protein sequence
Red=Cloning site Green=Tags(s) MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA YKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057182 |
RefSeq Size | 977 |
RefSeq ORF | 327 |
Synonyms | BRP44L; CGI-129; MPYCD; SLC54A1 |
Locus ID | 51660 |
UniProt ID | Q9Y5U8 |
Cytogenetics | 6q27 |
Summary | The protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.