Pirin (PIR) (NM_001018109) Human Mass Spec Standard
CAT#: PH300626
PIR MS Standard C13 and N15-labeled recombinant protein (NP_001018119)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200626 |
Predicted MW | 32.1 kDa |
Protein Sequence |
>RC200626 protein sequence
Red=Cloning site Green=Tags(s) MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER AKTWKSKIGN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001018119 |
RefSeq Size | 1542 |
RefSeq ORF | 870 |
Locus ID | 8544 |
UniProt ID | O00625, A0A024RBX6 |
Cytogenetics | Xp22.2 |
Summary | This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401212 | PIR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422656 | PIR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401212 | Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 1 |
USD 436.00 |
|
LY422656 | Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 2 |
USD 436.00 |
|
PH323111 | PIR MS Standard C13 and N15-labeled recombinant protein (NP_003653) |
USD 3,255.00 |
|
TP300626 | Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, 20 µg |
USD 867.00 |
|
TP323111 | Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review